Protein kinase Y linked (PRKY) (NM_002760) Human Recombinant Protein

CAT#: TP310438M

Recombinant protein of human protein kinase, Y-linked (PRKY), 100 µg

Product Images

Coomassie blue staining of purified PRKY protein (Cat# TP310438). The protein was produced from HEK293T cells transfected with PRKY cDNA clone (Cat# RC210438) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210438 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTFGRVHLVKEKT
  AKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRN
  RGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY
  LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002751
• Locus ID: 5616
• UniProt ID: O43930
• Cytogenetics: Yp11.2
• Refseq Size: 7216
• Refseq ORF: 831
• Synonyms: OTTHUMP00000033227; protein kinase, Y-linked
• Summary: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromosome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombination between this gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010]
• Protein Families: Druggable Genome, Protein Kinase