Interferon gamma (IFNG) (NM_000619) Human Recombinant Protein

SKU TP309993

Purified recombinant protein of Homo sapiens interferon, gamma (IFNG), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209993 protein sequence; Red=Cloning site Green=Tags(s); ; MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS; QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM; AELSPAAKTGKRKRSQMLFRGRRASQ; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000610
• Locus ID: 3458
• UniProt ID: P01579
• Cytogenetics: 12q15
• RefSeq Size: 1240
• RefSeq ORF: 498
• Synonyms: IFG; IFI; IMD69
• Summary: This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus