Fetuin A (AHSG) (NM_001622) Human Recombinant Protein

SKU
TP308344
Recombinant protein of human alpha-2-HS-glycoprotein (AHSG), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208344 protein sequence
Red=Cloning site Green=Tags(s)

MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWP
QQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAE
DVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVA
KEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPS
PPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA
AGPVVPPCPGRIRHFKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001613
Locus ID 197
UniProt ID P02765
Cytogenetics 3q27.3
RefSeq Size 1594
RefSeq ORF 1101
Synonyms A2HS; AHS; APMR1; FETUA; HSGA
Summary The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:Fetuin A (AHSG) (NM_001622) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308344 AHSG MS Standard C13 and N15-labeled recombinant protein (NP_001613) 10 ug
$3,255.00
LC400610 AHSG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400610 Transient overexpression lysate of alpha-2-HS-glycoprotein (AHSG) 100 ug
$436.00
TP720359 Recombinant protein of human alpha-2-HS-glycoprotein (AHSG) 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.