CBR1 (NM_001757) Human Recombinant Protein

CAT#: TP304950

Reviews ()
Write a review

Recombinant protein of human carbonyl reductase 1 (CBR1)



  View other "CBR1" proteins (3)

USD 823.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204950 protein sequence
Red=Cloning site Green=Tags(s)

MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSI
RALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSS
IMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHAR
KLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.2 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001748
Locus ID 873
UniProt ID P16152, A0A384NL53
Cytogenetics 21q22.12
Refseq Size 1321
Refseq ORF 831
Synonyms CBR; hCBR1; PG-9-KR; SDR21C1
Summary The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]
Protein Families Druggable Genome
Protein Pathways Arachidonic acid metabolism, Metabolic pathways

Documents

Other Versions

Other products for "CBR1"
Frequently bought together (2)
CBR1 mouse monoclonal antibody,clone OTI4B4
    • 100 ul

USD 417.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 385.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.