Frataxin (FXN) (NM_000144) Human Recombinant Protein

CAT#: TP304880M

Recombinant protein of human frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 1

Size: 20 ug 100 ug 1 mg



USD 2,950.00

8 Weeks*

Size
    • 100 ug

Product Images

Frequently bought together (2)
FXN (Frataxin) mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), HRP conjugated
    • 100 ul

USD 509.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204880 protein sequence
Red=Cloning site Green=Tags(s)

MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKK
QSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL
GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.1 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Applications Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000135
Locus ID 2395
UniProt ID Q16595, A0A0S2Z3G4
Cytogenetics 9q21.11
Refseq Size 7168
Refseq ORF 630
Synonyms CyaY; FA; FARR; FRDA; X25
Summary This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.