Alkaline Phosphatase (ALPPL2) (NM_031313) Human Recombinant Protein

CAT#: TP304330L

Recombinant protein of human alkaline phosphatase, placental-like 2 (ALPPL2), 1 mg

Size: 20 ug 100 ug 1 mg


USD 9,200.00

5 Days*

Size
    • 1 mg

Product Images

Frequently bought together (2)
Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
    • 100 ul

USD 625.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Alkaline Phosphatase"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC204330 representing NM_031313
Red=Cloning site Green=Tags(s)

MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTA
ARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQC
NTTRGNEVISVVNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLI
SNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPS
VTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTET
IMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPY
TACDLAPPAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_112603
Locus ID 251
UniProt ID P10696
Cytogenetics 2q37.1
Refseq Size 2485
Refseq ORF 1596
Synonyms ALPPL; ALPPL2; GCAP
Summary There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.