RTN4IP1 (NM_032730) Human Recombinant Protein

CAT#: TP302957M

Recombinant protein of human reticulon 4 interacting protein 1 (RTN4IP1), nuclear gene encoding mitochondrial protein, 100 µg

Product Images

Coomassie blue staining of purified RTN4IP1 protein (Cat# TP302957). The protein was produced from HEK293T cells transfected with RTN4IP1 cDNA clone (Cat# RC202957) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202957 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFTQNMMMPIIHY
  PNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPG
  DEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLI
  LGASGGVGTFAIQVMKAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGS
  TETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCL
  DDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_116119
• Locus ID: 84816
• UniProt ID: Q8WWV3
• Cytogenetics: 6q21
• Refseq Size: 2636
• Refseq ORF: 1188
• Synonyms: NIMP; OPA10
• Summary: This gene encodes a mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. This interaction may be important for reticulon-induced inhibition of neurite growth. Mutations in this gene can cause optic atrophy 10, with or without ataxia, cognitive disability, and seizures. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome