FUS (NM_004960) Human Recombinant Protein

SKU
TP301808L
Recombinant protein of human fusion (involved in t(12;16) in malignant liposarcoma) (FUS), 1 mg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$9,200.00
6 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201808 protein sequence
Red=Cloning site Green=Tags(s)

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS
TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ
QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ
QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD
NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA
IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD
RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.2 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Transmission electron microscopy (PMID: 26286827)
Co-immunoprecipitation (PMID: 27164932)
In vitro kinase assay inhibitor (PMID: 29513652)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004951
Locus ID 2521
UniProt ID P35637
Cytogenetics 16p11.2
RefSeq Size 5119
RefSeq ORF 1578
Synonyms ALS6; altFUS; ETM4; FUS1; HNRNPP2; POMP75; TLS
Summary This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq, Sep 2009]
Protein Families Druggable Genome, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:FUS (NM_004960) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.