OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FUS (NM_004960) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301808
Recombinant protein of human fusion (involved in t(12;16) in malignant liposarcoma) (FUS), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA376385 FUS Rabbit polyclonal Antibody
100 ul
$475.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "FUS or NM_004960"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201808 protein sequence
Red=Cloning site Green=Tags(s)

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS
TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ
QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ
QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD
NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA
IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD
RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 53.2 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Transmission electron microscopy (PMID: 26286827)
Co-immunoprecipitation (PMID: 27164932)
In vitro kinase assay inhibitor (PMID: 29513652)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004951
Locus ID 2521
UniProt ID P35637
Cytogenetics 16p11.2
RefSeq Size 5119
RefSeq ORF 1578
Synonyms ALS6; altFUS; ETM4; FUS1; HNRNPP2; POMP75; TLS
Summary This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. provided by RefSeq, Sep 2009
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FUS" proteins (3)
SKU Description Size Price
PH301808 FUS MS Standard C13 and N15-labeled recombinant protein (NP_004951) 10 ug
$3,360.00
LC401541 Lyophilized FUS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401541 Transient overexpression lysate of fused in sarcoma (FUS), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

FUS controls muscle differentiation through phase separation-mediated recruitment of the transcription factors MEF2 and ETV5
Picchiarelli, Wienand, Megat et al
EMBO J (2026)
AI Summary: In this study, OriGene recombinant proteins—including ETV1 (TP310533), ETV4 (TP760035), ETV5 (TP761784), and MEF2A (TP312830)—were used to investigate the molecular interactions and functional roles of these transcription factors in FUS-mediated muscle differentiation.
Snippet: US recombinant protein (EMSA) Origene TP301808 ETV1 Origene TP310533 ETV4 Origene TP760035 ETV5 Origene TP761784 MEF2A Origene TP312830
FUS controls muscle differentiation and structure through LLPS mediated recruitment of MEF2 and ETV5
Picchiarelli, Wienand, Megat et al
bioRxiv (2024)
Cited by 4
Snippet: ombinant protein was obtained from Novus biologicals (NBP1-42462, immunoprecipitation) or Origene (# TP301808, EMSAs)). ETV1 (# TP310533), ETV4 (# TP760035), ETV5 (# TP761784) and MEF2A (# T
Molecular Dissection of FUS Points at Synergistic Effect of Low-Complexity Domains in Toxicity
Bogaert, Boeynaems, Kato et al
Cell Rep (2018) 24 (3), 529-537.e4 DOI: 10.1016/j.celrep.2018.06.070
AI Summary: OriGene contributed to this study by providing the CMV6 FUS-FLAG WT plasmid, which was used to investigate the molecular mechanisms of FUS toxicity in neurodegenerative disease models.
Snippet: l7017 ------------------------- Oligonucleotides ------------------------- Primers IDT N/A ------------------------- Recombinant DNA ------------------------- CMV6 FUS-FLAG WT plasmid Origene TP301808 CMV6 FUS-FLAG MT plasmids Biomatic This study FUS-GFP plasmid Dr. Simon Alberti Patel et al., 2015 Contact for Reagent and Resource Sharing Further information and r;All deletion and RGG mutant FUS constructs were obtained from Biomatik (Ontario, Canada). GFP tagged FUS constructs were a kind gift from Dr. Simon Alberti (Max Planck Institute, Germany). C-terminally Flag tagged FUS was purchased from Origene (Maryland, USA). …
EWS-FLI1 increases transcription to cause R-loops and block BRCA1 repair in Ewing sarcoma
Gorthi, Romero, Loranc et al
Nature (2018) 555 (7696), 387-391 DOI: 10.1038/nature25748
AI Summary: OriGene’s recombinant EWSR1 (TP303709) and FUS (TP301808) proteins were used in in vitro assays to investigate how EWS-FLI1 alters transcription and contributes to DNA repair defects in Ewing sarcoma.
Snippet: In vitro RNAPII phosphorylation assay. The following purified recombinant proteins were purchased: RNAPII CTD fragment (POLR2A-1149H, Creative BioMart), EWSR1 (TP303709, Origene), FUS (TP301808, Origene) and CDK9/cyclin T1 (PV4131, Thermo Fisher Scientific
Comparative interactomics analysis of different ALS-associated proteins identifies converging molecular pathways
Blokhuis, Koppers, Groen et al
Acta Neuropathol. (2016)
Cited by 146
AI Summary: OriGene's recombinant FUS protein was used in this study to investigate direct and RNA-dependent interactions between ALS-associated proteins and FMRP, helping to elucidate converging molecular pathways in ALS pathogenesis.
Snippet: Precipitated proteins were eluted by boiling in NuPage LDS sample buffer containing 10 mM DTT for 5 min at 90 °C. For RNA dependency experiments, lysates were first treated with RNAse A (Roche) for 30 min at 4 °C. Recombinant FUS (Origene) and FMRP (Abnova ... Cite SaveSaving
Liquid demixing of intrinsically disordered proteins is seeded by poly(ADP-ribose)
Altmeyer, Neelsen, Teloni et al
Nat Commun (2015) 6, 8088 DOI: 10.1038/ncomms9088
Cited by 612
AI Summary: OriGene’s recombinant FUS and EWS proteins were used in experiments to study how poly(ADP-ribose) seeds liquid demixing of intrinsically disordered proteins, contributing to the investigation of phase separation mechanisms at DNA damage sites.
Snippet: For experiments with full-length proteins, recombinant FUS (OriGene), EWS (OriGene) and TAF15 (Abnova) were used. S
Showing 1-6 of 7 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products