FUS (NM_004960) Human Recombinant Protein

CAT#: TP301808

Recombinant protein of human fusion (involved in t(12;16) in malignant liposarcoma) (FUS), 20 µg

Product Images

Recombinant FMRP and FUS proteins (TP301808) were mixed and RNA was added in increasing concentrations. Protein mixtures were incubated and immunoprecipitated with anti-FUS antibody and subjected to immunoblotting with the indicated antibodies. Figure cited from Acta Neuropathol 2016. PMID: 27164932

• 

  Purified FUS (TP301808) and SMN proteins (TP321108) were mixed and immunoprecipitated with IgG (control) or anti-FUS antibodies. Immunoprecipitates were analyzed with the indicated antibodies. Figure cited from Hum. Mol. Genet. 2013, PMID: 23681068

• 

  Full-length recombinant FUS/TLS (OriGene TP301808) was incubated at 37 C for 24 hours with or without sub-stoichiometric amounts of purified PAR. Protein aggregates were analyzed by transmission electron microscopy. Figure cited from Nat Commun, PMID: 26286827

• 

  Characterization of FMRP-FUS binding. Recombinant FUS (OriGene TP301808) and FMRP proteins were mixed and immunoprecipitated with anti-FUS antibodies. Samples were analyzed in Western blot with the indicated antibodies. Figure cited from Acta Neuropathol, PMID: 27164932

• 

  Coomassie blue staining of purified FUS protein (Cat# TP301808). The protein was produced from HEK293T cells transfected with FUS cDNA clone (Cat# RC201808) using MegaTran 2.0 (Cat# TT210002).

Show all 5 images

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201808 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS
  TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ
  QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ
  QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD
  NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA
  IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
  QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD
  RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 53.2 kDa
• Concentration: >0.1 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Transmission electron microscopy (PMID: 26286827)
  Co-immunoprecipitation (PMID: 27164932)
  In vitro kinase assay inhibitor (PMID: 29513652)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004951
• Locus ID: 2521
• UniProt ID: P35637, Q6IBQ5
• Cytogenetics: 16p11.2
• Refseq Size: 5119
• Refseq ORF: 1578
• Synonyms: ALS6; altFUS; ETM4; FUS1; HNRNPP2; POMP75; TLS
• Summary: This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome, Stem cell - Pluripotency