PLK1 (NM_005030) Human Recombinant Protein

CAT#: TP301795M

Recombinant protein of human polo-like kinase 1 (Drosophila) (PLK1), 100 µg

Product Images

Coomassie blue staining of purified PLK1 protein (Cat# TP301795). The protein was produced from HEK293T cells transfected with PLK1 cDNA clone (Cat# RC201795) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201795 representing NM_005030
  Red=Cloning site Green=Tags(s)
  
  MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEI
  SDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLE
  LHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKT
  LCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAAS
  LIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENP
  LPERPREKEEPVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
  YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHL
  LKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFR
  TYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 68.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: In vitro kinase assay substrate (ELISA) (PMID: 28024153)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005021
• Locus ID: 5347
• UniProt ID: P53350
• Cytogenetics: 16p12.2
• Refseq Size: 2204
• Refseq ORF: 1809
• Synonyms: PLK; STPK13
• Summary: The Ser/Thr protein kinase encoded by this gene belongs to the CDC5/Polo subfamily. It is highly expressed during mitosis and elevated levels are found in many different types of cancer. Depletion of this protein in cancer cells dramatically inhibited cell proliferation and induced apoptosis; hence, it is a target for cancer therapy. [provided by RefSeq, Sep 2015]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation