SULT1A1 (NM_001055) Human Recombinant Protein

SKU
TP301601
Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201601 protein sequence
Red=Cloning site Green=Tags(s)

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKC
HRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYY
HFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF
VGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY
AEKMAGCSLSFRSEL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001046
Locus ID 6817
UniProt ID P50225
Cytogenetics 16p11.2
RefSeq Size 1254
RefSeq ORF 885
Synonyms HAST1/HAST2; P-PST; P-PST 1; PST; ST1A1; ST1A3; STP; STP1; ts-PST; TSPST1
Summary Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Pathways Sulfur metabolism
Write Your Own Review
You're reviewing:SULT1A1 (NM_001055) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301601 SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001046) 10 ug
$3,255.00
PH311105 SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803566) 10 ug
$3,255.00
PH312038 SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803565) 10 ug
$3,255.00
PH312198 SULT1A1 MS Standard C13 and N15-labeled recombinant protein (NP_803878) 10 ug
$3,255.00
LC406098 SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406099 SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406103 SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406105 SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420735 SULT1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406098 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2 100 ug
$436.00
LY406099 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3 100 ug
$436.00
LY406103 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4 100 ug
$436.00
LY406105 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 5 100 ug
$436.00
LY420735 Transient overexpression lysate of sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 100 ug
$436.00
TP311105 Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312038 Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312198 Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720941 Purified recombinant protein of Human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.