IRF6 (NM_006147) Human Recombinant Protein
CAT#: TP301579
Recombinant protein of human interferon regulatory factor 6 (IRF6), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201579 protein sequence
Red=Cloning site Green=Tags(s) MALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQEEENTIFKAWAVETGKYQEG VDDPDPAKWKAQLRCALNKSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDND VDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPKTEPLEMEVPQAPIQPF YSSPELWISSLPMTDLDIKFQYRGKEYGQTMTVSNPQGCRLFYGDLGPMPDQEELFGPVSLEQVKFPGPE HITNEKQKLFTSKLLDVMDRGLILEVSGHAIYAIRLCQCKVYWSGPCAPSLVAPNLIERQKKVKLFCLET FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVR LQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006138 |
Locus ID | 3664 |
UniProt ID | O14896, G0Z349 |
Cytogenetics | 1q32.2 |
Refseq Size | 4505 |
Refseq ORF | 1401 |
Synonyms | LPS; OFC6; PIT; PPS; PPS1; VWS; VWS1 |
Summary | This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2011] |
Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401852 | IRF6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401852 | Transient overexpression lysate of interferon regulatory factor 6 (IRF6) |
USD 436.00 |
|
PH301579 | IRF6 MS Standard C13 and N15-labeled recombinant protein (NP_006138) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review