RAB10 (NM_016131) Human Recombinant Protein

CAT#: TP301464

Recombinant protein of human RAB10, member RAS oncogene family (RAB10), 20 µg

Product Images

Coomassie blue staining of purified RAB10 protein (Cat# TP301464). The protein was produced from HEK293T cells transfected with RAB10 cDNA clone (Cat# RC201464) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201464 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER
  FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI
  AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057215
• Locus ID: 10890
• UniProt ID: P61026
• Cytogenetics: 2p23.3
• Refseq Size: 3785
• Refseq ORF: 600
• Summary: RAB10 belongs to the RAS (see HRAS; MIM 190020) superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking (Bao et al., 1998 [PubMed 9918381]).[supplied by OMIM, Mar 2009]
• Protein Families: Druggable Genome