GADD45G (NM_006705) Human Recombinant Protein

CAT#: TP301364L

Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G)

Size: 20 ug 100 ug 1 mg



USD 9,200.00

9 Weeks*

Size
    • 1 mg

Product Images

Frequently bought together (2)
GADD45G mouse monoclonal antibody,clone 2C1, HRP conjugated
    • 100 ul

USD 509.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "GADD45G"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201364 protein sequence
Red=Cloning site Green=Tags(s)

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL
FCEESRSVNDWVPSITLPE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.9 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Applications Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_006696
Locus ID 10912
UniProt ID O95257
Cytogenetics 9q22.2
Refseq Size 1087
Refseq ORF 477
Synonyms CR6; DDIT2; GADD45gamma; GRP17
Summary This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]
Protein Pathways Cell cycle, MAPK signaling pathway, p53 signaling pathway

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.