Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Recombinant Protein

SKU
TP301144
Recombinant protein of human phosphoribosyl pyrophosphate amidotransferase (PPAT), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201144 protein sequence
Red=Cloning site Green=Tags(s)

MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLV
NHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGI
GLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGR
LIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFC
IFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKN
RYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQEN
GNGLECFEKSGHCTACLTGKYPVELEW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 57.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002694
Locus ID 5471
UniProt ID Q06203
Cytogenetics 4q12
RefSeq Size 3713
RefSeq ORF 1551
Synonyms ATASE; GPAT; PRAT
Summary The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. It is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosythetic pathway. This gene and PAICS/AIRC gene, a bifunctional enzyme catalyzing steps six and seven of this pathway, are located in close proximity on chromosome 4, and divergently transcribed from an intergenic region. [provided by RefSeq, Mar 2011]
Protein Families Druggable Genome, Protease
Protein Pathways Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism
Write Your Own Review
You're reviewing:Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301144 PPAT MS Standard C13 and N15-labeled recombinant protein (NP_002694) 10 ug
$3,255.00
LC400951 PPAT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400951 Transient overexpression lysate of phosphoribosyl pyrophosphate amidotransferase (PPAT) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.