Phosphoribosyl pyrophosphate amidotransferase (PPAT) (NM_002703) Human Recombinant Protein

CAT#: TP301144

Recombinant protein of human phosphoribosyl pyrophosphate amidotransferase (PPAT), 20 µg

Product Images

Coomassie blue staining of purified PPAT protein (Cat# TP301144). The protein was produced from HEK293T cells transfected with PPAT cDNA clone (Cat# RC201144) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201144 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLV
  NHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGI
  GLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGR
  LIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFC
  IFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKN
  RYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
  PIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQEN
  GNGLECFEKSGHCTACLTGKYPVELEW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 57.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002694
• Locus ID: 5471
• UniProt ID: Q06203, A8K4H7, Q59G63
• Cytogenetics: 4q12
• Refseq Size: 3713
• Refseq ORF: 1551
• Synonyms: ATASE; GPAT; PRAT
• Summary: The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. It is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosythetic pathway. This gene and PAICS/AIRC gene, a bifunctional enzyme catalyzing steps six and seven of this pathway, are located in close proximity on chromosome 4, and divergently transcribed from an intergenic region. [provided by RefSeq, Mar 2011]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism