ICAM1 (NM_000201) Human Recombinant Protein

SKU
TP300714
Purified recombinant protein of Homo sapiens intercellular adhesion molecule 1 (ICAM1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200714 representing NM_000201
Red=Cloning site Green=Tags(s)

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELL
LPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGG
APRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQ
TFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTA
EDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL
GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYEIVIITVVAAA
VIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000192
Locus ID 3383
UniProt ID P05362
Cytogenetics 19p13.2
RefSeq Size 2986
RefSeq ORF 1596
Synonyms BB2; CD54; P3.58
Summary This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Viral myocarditis
Write Your Own Review
You're reviewing:ICAM1 (NM_000201) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300714 ICAM1 MS Standard C13 and N15-labeled recombinant protein (NP_000192) 10 ug
$3,255.00
LC400073 ICAM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400073 Transient overexpression lysate of intercellular adhesion molecule 1 (ICAM1) 100 ug
$436.00
TP720283 Recombinant protein of human intercellular adhesion molecule 1 (ICAM1) 10 ug
$230.00
TP721375 Recombinant mouse ICAM-1/CD54 protein 10 ug
$225.00
TP723972 Human ICAM-1 Protein, mFc Tag 100 ug
$595.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.