FH (NM_000143) Human Recombinant Protein

SKU
TP300614
Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200614 protein sequence
Red=Cloning site Green=Tags(s)

MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAARMASQNSFRIEYDTFGELKVPNDKYYGA
QTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVV
WQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPG
LQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVG
TGLNTRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPR
SGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSA
RLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELG
YLTAEQFDEWVKPKDMLGPK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000134
Locus ID 2271
UniProt ID P07954
Cytogenetics 1q43
RefSeq Size 1877
RefSeq ORF 1530
Synonyms FMRD; HLRCC; HsFH; LRCC; MCL; MCUL1
Summary The protein encoded by this gene is an enzymatic component of the tricarboxylic acid (TCA) cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Citrate cycle (TCA cycle), Metabolic pathways, Pathways in cancer, Renal cell carcinoma
Write Your Own Review
You're reviewing:FH (NM_000143) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300614 FH MS Standard C13 and N15-labeled recombinant protein (NP_000134) 10 ug
$3,255.00
LC400053 FH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400053 Transient overexpression lysate of fumarate hydratase (FH), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP720199 Recombinant protein of human fumarate hydratase (FH), nuclear gene encoding mitochondrial protein 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.