ENOX1 (NM_001127615) Human Mass Spec Standard

SKU
PH326055
ENOX1 MS Standard C13 and N15-labeled recombinant protein (NP_001121087)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226055]
Predicted MW 73.3 kDa
Protein Sequence
Protein Sequence
>RC226055 protein sequence
Red=Cloning site Green=Tags(s)

MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD
SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG
CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD
SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS
EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV
AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES
ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE
LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ
GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK
RWKLCAFEGIKTT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121087
RefSeq Size 2706
RefSeq ORF 1929
Synonyms bA64J21.1; cCNOX; CNOX; PIG38
Locus ID 55068
UniProt ID Q8TC92
Cytogenetics 13q14.11
Summary The protein encoded by this gene is involved in plasma membrane electron transport pathways. The encoded protein has both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity. The two activities cycle with a periodicity of 24 minutes, with one activity being at its peak when the other is at its lowest. [provided by RefSeq, Dec 2016]
Write Your Own Review
You're reviewing:ENOX1 (NM_001127615) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305232 ENOX1 MS Standard C13 and N15-labeled recombinant protein (NP_060463) 10 ug
$3,255.00
LC402636 ENOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426824 ENOX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402636 Transient overexpression lysate of ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 1 100 ug
$436.00
LY426824 Transient overexpression lysate of ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 2 100 ug
$436.00
TP305232 Recombinant protein of human ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326055 Recombinant protein of human ecto-NOX disulfide-thiol exchanger 1 (ENOX1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.