C13orf31 (LACC1) (NM_001128303) Human Mass Spec Standard

SKU
PH325705
C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_001121775)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225705]
Predicted MW 47.8 kDa
Protein Sequence
Protein Sequence
>RC225705 protein sequence
Red=Cloning site Green=Tags(s)

MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS
ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG
GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF
NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL
GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA
EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG
TQIGFISIKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121775
RefSeq Size 4288
RefSeq ORF 1290
Synonyms C13orf31; FAMIN; JUVAR
Locus ID 144811
UniProt ID Q8IV20
Cytogenetics 13q14.11
Summary This gene encodes an oxidoreductase that promotes fatty-acid oxidation, with concomitant inflammasome activation, mitochondrial and NADPH-oxidase-dependent reactive oxygen species production, and bactericidal activity of macrophages. The encoded protein forms a complex with fatty acid synthase on peroxisomes and is thought to be modulated by peroxisome proliferator-activated receptor signaling events. Naturally occurring mutations in this gene are associated with inflammatory bowel disease, Behcet's disease, leprosy, ulcerative colitis, early-onset Crohn's disease, and systemic juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017]
Write Your Own Review
You're reviewing:C13orf31 (LACC1) (NM_001128303) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307834 C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_694950) 10 ug
$3,255.00
LC407147 LACC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426942 LACC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407147 Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 2 100 ug
$436.00
LY426942 Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 1 100 ug
$436.00
TP307834 Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 2, 20 µg 20 ug
$867.00
TP325705 Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.