JMJD7 (NM_001114632) Human Mass Spec Standard

SKU
PH325450
JMJD7 MS Standard C13 and N15-labeled recombinant protein (NP_001108104)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225450]
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC225450 representing NM_001114632
Red=Cloning site Green=Tags(s)

MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQHWPALQKWSLP
YFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELP
QLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHFLFHPPSDRPFIPYEL
YTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQ
QSQGCIAVNFWYDMEYDLKYSYFQLLDSLTKASGLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001108104
RefSeq ORF 948
Locus ID 100137047
UniProt ID P0C870
Cytogenetics 15q15.1
Summary This gene encodes a highly conserved protein with a JmjC domain, which are part of the cupin metalloenzyme superfamily. JmjC proteins may function as 2-oxoglutarate-Fe(II)-dependent dioxygenases. Most tissues also express read-through transcripts from this gene into the downstream phospholipase A2, group IVB (cytosolic) gene, some of which may encode fusion proteins combining the N-terminus of this protein with the phospholipase A2, group IVB protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:JMJD7 (NM_001114632) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC426498 JMJD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY426498 Transient overexpression lysate of jumonji domain containing 7 (JMJD7) 100 ug
$436.00
TP325450 Recombinant protein of human jumonji domain containing 7 (JMJD7), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.