CSRP3 (NM_001127656) Human Mass Spec Standard
CAT#: PH325217
CSRP3 MS Standard C13 and N15-labeled recombinant protein (NP_001121128)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225217 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC225217 protein sequence
Red=Cloning site Green=Tags(s) MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001121128 |
RefSeq Size | 1464 |
RefSeq ORF | 582 |
Synonyms | CLP; CMD1M; CMH12; CRP3; LMO4; MLP |
Locus ID | 8048 |
UniProt ID | P50461 |
Cytogenetics | 11p15.1 |
Summary | This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418660 | CSRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426837 | CSRP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418660 | Transient overexpression lysate of cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 1 |
USD 436.00 |
|
LY426837 | Transient overexpression lysate of cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2 |
USD 436.00 |
|
TP325217 | Recombinant protein of human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review