H2BC14 (NM_003521) Human Mass Spec Standard

SKU
PH324252
HIST1H2BM MS Standard C13 and N15-labeled recombinant protein (NP_003512)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224252]
Predicted MW 14 kDa
Protein Sequence
Protein Sequence
>RC224252 protein sequence
Red=Cloning site Green=Tags(s)

MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003512
RefSeq Size 446
RefSeq ORF 378
Synonyms dJ160A22.3; H2B/e; H2BFE; HIST1H2BM
Locus ID 8342
UniProt ID Q99879
Cytogenetics 6p22.1
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015]
Protein Pathways Systemic lupus erythematosus
Write Your Own Review
You're reviewing:H2BC14 (NM_003521) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418609 HIST1H2BM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418609 Transient overexpression lysate of histone cluster 1, H2bm (HIST1H2BM) 100 ug
$436.00
TP324252 Recombinant protein of human histone cluster 1, H2bm (HIST1H2BM), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.