BTN3A1 (NM_007048) Human Mass Spec Standard

CAT#: PH316344

BTN3A1 MS Standard C13 and N15-labeled recombinant protein (NP_008979)

Product Images

Coomassie blue staining of purified BTN3A1 protein (Cat# TP316344). The protein was produced from HEK293T cells transfected with BTN3A1 cDNA clone (Cat# RC216344) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216344
• Predicted MW: 57.7 kDa
• Protein Sequence:
  Sequence Link

  >RC216344 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS
  SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE
  LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM
  RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ
  FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN
  PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG
  WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKTPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF
  SEALYPVFRILTLEPTALTICPA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008979
• RefSeq Size: 3434
• RefSeq ORF: 1539
• Synonyms: BT3.1; BTF5; BTN3.1; CD277
• Locus ID: 11119
• UniProt ID: O00481
• Cytogenetics: 6p22.2
• Summary: The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A1) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010 [PubMed 20208008]).[supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome, Transmembrane