BTN3A1 (NM_007048) Human Mass Spec Standard

SKU
PH316344
BTN3A1 MS Standard C13 and N15-labeled recombinant protein (NP_008979)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216344]
Predicted MW 57.7 kDa
Protein Sequence
Protein Sequence
>RC216344 protein sequence
Red=Cloning site Green=Tags(s)

MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE
LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM
RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ
FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN
PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG
WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKTPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF
SEALYPVFRILTLEPTALTICPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008979
RefSeq Size 3434
RefSeq ORF 1539
Synonyms BT3.1; BTF5; BTN3.1; CD277
Locus ID 11119
UniProt ID O00481
Cytogenetics 6p22.2
Summary The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A1) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010 [PubMed 20208008]).[supplied by OMIM, Nov 2010]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:BTN3A1 (NM_007048) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416231 BTN3A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428640 BTN3A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416231 Transient overexpression lysate of butyrophilin, subfamily 3, member A1 (BTN3A1), transcript variant 1 100 ug
$665.00
LY428640 Transient overexpression lysate of butyrophilin, subfamily 3, member A1 (BTN3A1), transcript variant 4 100 ug
$436.00
TP316344 Recombinant protein of human butyrophilin, subfamily 3, member A1 (BTN3A1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP723969 Human BTN3A1 Protein, mFc-His Tag 100 ug
$595.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.