GALP (NM_033106) Human Mass Spec Standard

SKU PH316301

GALP MS Standard C13 and N15-labeled recombinant protein (NP_149097)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC216301]
• Predicted MW: 12.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC216301 representing NM_033106; Red=Cloning site Green=Tags(s); ; MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWK; AIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_149097
• RefSeq Size: 947
• RefSeq ORF: 348
• Locus ID: 85569
• UniProt ID: Q9UBC7
• Cytogenetics: 19q13.43
• Summary: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, has vasoactive properties, displays antimicrobial activity against E. coli, and may serve as a marker for neuroblastic tumors.[provided by RefSeq, Nov 2014]
• Protein Families: Secreted Protein