SPACA9 (NM_018956) Human Mass Spec Standard

SKU
PH316076
C9orf9 MS Standard C13 and N15-labeled recombinant protein (NP_061829)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216076]
Predicted MW 19.1 kDa
Protein Sequence
Protein Sequence
>RC216076 representing NM_018956
Red=Cloning site Green=Tags(s)

MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFL
DICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSL
IPLILDLMKEWIAHSEKLPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGC
SKPPWRPPGGKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061829
RefSeq Size 2214
RefSeq ORF 666
Synonyms C9orf9; Mast
Locus ID 11092
UniProt ID Q96E40
Cytogenetics 9q34.13
Write Your Own Review
You're reviewing:SPACA9 (NM_018956) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412860 C9orf9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412860 Transient overexpression lysate of chromosome 9 open reading frame 9 (C9orf9) 100 ug
$436.00
TP316076 Recombinant protein of human chromosome 9 open reading frame 9 (C9orf9), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.