Estrogen Related Receptor beta (ESRRB) (NM_004452) Human Mass Spec Standard

SKU
PH315995
ESRRB MS Standard C13 and N15-labeled recombinant protein (NP_004443)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215995]
Predicted MW 56 kDa
Protein Sequence
Protein Sequence
>RC215995 representing NM_004452
Red=Cloning site Green=Tags(s)

MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGT
PCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCP
ATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLT
KIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAW
MEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA
NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP
MHKLFLEMLEAKAWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPLPPPPSVAWVGTAQAGYHLEVFL
PQRAGWPRAA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004443
RefSeq Size 2193
RefSeq ORF 1500
Synonyms DFNB35; ERR2; ERRb; ERR beta-2; ERRbeta2; ESRL2; NR3B2
Locus ID 2103
UniProt ID O95718
Cytogenetics 14q24.3
Summary This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Write Your Own Review
You're reviewing:Estrogen Related Receptor beta (ESRRB) (NM_004452) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401414 ESRRB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432280 ESRRB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401414 Transient overexpression lysate of estrogen-related receptor beta (ESRRB) 100 ug
$665.00
LY432280 Transient overexpression lysate of estrogen-related receptor beta (ESRRB) 100 ug
$436.00
TP315995 Purified recombinant protein of Homo sapiens estrogen-related receptor beta (ESRRB), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.