ATP8B2 (NM_001005855) Human Mass Spec Standard

SKU
PH315926
ATP8B2 MS Standard C13 and N15-labeled recombinant protein (NP_001005855)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215926]
Predicted MW 44 kDa
Protein Sequence
Protein Sequence
>RC215926 representing NM_001005855
Red=Cloning site Green=Tags(s)

MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLI
PQISSLSWFTTIVPLVLVLTITAVKDATDDYFRHKSDNQVNNRQSQVLINGILQQEQWMNVCVGDIIKLE
NNQFVAADLLLLSSSEPHGLCYIETAELDGETNMKVRQAIPVTSELGDISKLAKFDGEVICEPPNNKLDK
FSGTLYWKENKFPLSNQNMLLRGCVLRNTEWCFGLVIFAGPDTKLMQNSGRTKFKRTSIDRLMNTLVLWI
FGFLVCMGVILAIGNAIWEHEVGMRFQVYLPWDEAVDSAFFSGFLSFWSYIIILNTVVPISLYVRYVPSL
TWGLSRESGGPIELFFSMKMKSLRSNEKSSSSCTVNI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001005855
RefSeq Size 1560
RefSeq ORF 1161
Synonyms ATPID
Locus ID 57198
UniProt ID P98198
Cytogenetics 1q21.3
Summary The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ATP8B2 (NM_001005855) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC423664 ATP8B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423664 Transient overexpression lysate of ATPase, class I, type 8B, member 2 (ATP8B2), transcript variant 2 100 ug
$436.00
TP315926 Recombinant protein of human ATPase, class I, type 8B, member 2 (ATP8B2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.