PGRPL (PGLYRP2) (NM_052890) Human Mass Spec Standard

SKU
PH315773
PGLYRP2 MS Standard C13 and N15-labeled recombinant protein (NP_443122)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215773]
Predicted MW 62 kDa
Protein Sequence
Protein Sequence
>RC215773 representing NM_052890
Red=Cloning site Green=Tags(s)

MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFL
LGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINL
PLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKS
PPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGV
ILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVH
LQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT
DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAAL
PTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKR
SRREPPPRTLPATDLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443122
RefSeq Size 1901
RefSeq ORF 1728
Synonyms HMFT0141; PGLYRPL; PGRP-L; PGRPL; tagL; tagL-alpha; tagl-beta; TAGL-like
Locus ID 114770
UniProt ID Q96PD5
Cytogenetics 19p13.12
Summary This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments. [provided by RefSeq, Sep 2011]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:PGRPL (PGLYRP2) (NM_052890) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403265 PGLYRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403265 Transient overexpression lysate of peptidoglycan recognition protein 2 (PGLYRP2) 100 ug
$665.00
TP315773 Recombinant protein of human peptidoglycan recognition protein 2 (PGLYRP2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.