OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGRPL (PGLYRP2) (NM_052890) Human Mass Spec Standard

Be the first to review this product
SKU
PH315773
PGLYRP2 MS Standard C13 and N15-labeled recombinant protein (NP_443122)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379849 PGLYRP2 Rabbit polyclonal Antibody
100 ul
$410.00
LY403265 Transient overexpression lysate of peptidoglycan recognition protein 2 (PGLYRP2) (as WB positive control) 100 ug
$665.00

Other products for "PGRPL or NM_052890"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215773
Predicted MW 62 kDa
Protein Sequence
Protein Sequence
>RC215773 representing NM_052890
Red=Cloning site Green=Tags(s)

MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNSGPHNRLYHFL
LGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINL
PLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDVTTADIGANTPDATKGCPDVQASLPDAKAKS
PPTMVDSLLAVTLAGNLGLTFLRGSQTQSHPDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGV
ILGDYLSRTPEPRPSLSHLLSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVH
LQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT
DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGVAIVGNYTAAL
PTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKR
SRREPPPRTLPATDLQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443122
RefSeq Size 1901
RefSeq ORF 1728
Synonyms HMFT0141; PGLYRPL; PGRP-L; PGRPL; tagL; tagL-alpha; tagl-beta; TAGL-like
Locus ID 114770
UniProt ID Q96PD5
Cytogenetics 19p13.12
Summary This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments. provided by RefSeq, Sep 2011
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PGRPL" proteins (3)
SKU Description Size Price
LC403265 Lyophilized PGLYRP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403265 Transient overexpression lysate of peptidoglycan recognition protein 2 (PGLYRP2) (as WB positive control) 100 ug
$665.00
TP315773 Recombinant protein of human peptidoglycan recognition protein 2 (PGLYRP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products