Growth Arrest Specific Protein 7 (GAS7) (NM_003644) Human Mass Spec Standard

SKU
PH315256
GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215256]
Predicted MW 39 kDa
Protein Sequence
Protein Sequence
>RC215256 representing NM_003644
Red=Cloning site Green=Tags(s)

MSNMENSFDDVSCLSPQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD
PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK
SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL
EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR
QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003635
RefSeq Size 7773
RefSeq ORF 1008
Locus ID 8522
UniProt ID O60861
Cytogenetics 17p13.1
Summary Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Growth Arrest Specific Protein 7 (GAS7) (NM_003644) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300285 GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836) 10 ug
$3,255.00
LC404414 GAS7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404415 GAS7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418527 GAS7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404414 Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant b 100 ug
$436.00
LY404415 Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant c 100 ug
$665.00
LY418527 Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant a 100 ug
$436.00
TP300285 Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315256 Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720200 Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant d 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.