SNTN (NM_001080537) Human Mass Spec Standard

SKU
PH314753
SNTN MS Standard C13 and N15-labeled recombinant protein (NP_001074006)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214753]
Predicted MW 16.3 kDa
Protein Sequence
Protein Sequence
>RC214753 representing NM_001080537
Red=Cloning site Green=Tags(s)

MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNS
SDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQNI
RNVKIMK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001074006
RefSeq Size 1586
RefSeq ORF 441
Synonyms S100A1L; S100AL; sentan
Locus ID 132203
UniProt ID A6NMZ2
Cytogenetics 3p14.2
Summary May be a component of the linker structure that bridges the ciliary membrane and peripheral singlet microtubules.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SNTN (NM_001080537) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421091 SNTN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421091 Transient overexpression lysate of sentan, cilia apical structure protein (SNTN) 100 ug
$436.00
TP314753 Recombinant protein of human sentan, cilia apical structure protein (SNTN), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.