OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NPL (NM_030769) Human Mass Spec Standard

Be the first to review this product
SKU
PH314546
NPL MS Standard C13 and N15-labeled recombinant protein (NP_110396)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365284 NPL rabbit polyclonal antibody
100 ul
$310.00
LY410719 Transient overexpression lysate of N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (NPL) (as WB positive control) 100 ug
$436.00

Other products for "NPL or NM_030769"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214546
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC214546 protein sequence
Red=Cloning site Green=Tags(s)

MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW
VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF
YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM
GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP
PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110396
RefSeq Size 2867
RefSeq ORF 960
Synonyms C1orf13; C112; NAL; NPL1
Locus ID 80896
UniProt ID Q9BXD5
Cytogenetics 1q25.3
Summary This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha)(8)-barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Jan 2011
Protein Pathways Amino sugar and nucleotide sugar metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NPL" proteins (3)
SKU Description Size Price
LC410719 Lyophilized NPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410719 Transient overexpression lysate of N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (NPL) (as WB positive control) 100 ug
$436.00
TP314546 Recombinant protein of human N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) (NPL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products