NPL (NM_030769) Human Mass Spec Standard

CAT#: PH314546

NPL MS Standard C13 and N15-labeled recombinant protein (NP_110396)

Product Images

Coomassie blue staining of purified NPL protein (Cat# TP314546). The protein was produced from HEK293T cells transfected with NPL cDNA clone (Cat# RC214546) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC214546
• Predicted MW: 35.2 kDa
• Protein Sequence:
  Sequence Link

  >RC214546 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW
  VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF
  YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM
  GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP
  PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_110396
• RefSeq Size: 2867
• RefSeq ORF: 960
• Synonyms: C1orf13; C112; NAL; NPL1
• Locus ID: 80896
• UniProt ID: Q9BXD5
• Cytogenetics: 1q25.3
• Summary: This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha)(8)-barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
• Protein Pathways: Amino sugar and nucleotide sugar metabolism