CT45A4 (NM_001017436) Human Mass Spec Standard

SKU
PH313242
CT45A4 MS Standard C13 and N15-labeled recombinant protein (NP_001017436)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213242]
Predicted MW 21.1 kDa
Protein Sequence
Protein Sequence
>RC213242 representing NM_001017436
Red=Cloning site Green=Tags(s)

MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD
SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK
YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001017436
RefSeq Size 1008
RefSeq ORF 567
Synonyms CT45-4; CT45.4
Locus ID 441520
Cytogenetics Xq26.3
Write Your Own Review
You're reviewing:CT45A4 (NM_001017436) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422733 CT45A4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422733 Transient overexpression lysate of cancer/testis antigen family 45, member A4 (CT45A4) 100 ug
$436.00
TP313242 Purified recombinant protein of Homo sapiens cancer/testis antigen family 45, member A4 (CT45A4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.