AMELY (NM_001143) Human Mass Spec Standard

SKU
PH312029
AMELY MS Standard C13 and N15-labeled recombinant protein (NP_001134)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212029]
Predicted MW 21.73 kDa
Protein Sequence
Protein Sequence
>RC212029 representing NM_001143
Red=Cloning site Green=Tags(s)

MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVV
SQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQP
MQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001134
RefSeq Size 802
RefSeq ORF 576
Synonyms AMGL; AMGY
Locus ID 266
UniProt ID Q99218
Cytogenetics Yp11.2
Summary This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:AMELY (NM_001143) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420106 AMELY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420106 Transient overexpression lysate of amelogenin, Y-linked (AMELY) 100 ug
$436.00
TP312029 Recombinant protein of human amelogenin, Y-linked (AMELY), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.