AMELY (NM_001143) Human Mass Spec Standard

CAT#: PH312029

AMELY MS Standard C13 and N15-labeled recombinant protein (NP_001134)

Product Images

Coomassie blue staining of purified AMELY protein (Cat# TP312029). The protein was produced from HEK293T cells transfected with AMELY cDNA clone (Cat# RC212029) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212029
• Predicted MW: 21.73 kDa
• Protein Sequence:
  Sequence Link

  >RC212029 representing NM_001143
  Red=Cloning site Green=Tags(s)
  
  MGTWILFACLVGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVV
  SQQHPLTHTLQSHHHIPVVPAQQPRVRQQALMPVPGQQSMTPTQHHQPNLPLPAQQPFQPQPVQPQPHQP
  MQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQEEVD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001134
• RefSeq Size: 802
• RefSeq ORF: 576
• Synonyms: AMGL; AMGY
• Locus ID: 266
• UniProt ID: Q99218
• Cytogenetics: Yp11.2
• Summary: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein