LRP5L (NM_182492) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC211399] |
Predicted MW | 28.3 kDa |
Protein Sequence |
Protein Sequence
>RC211399 representing NM_182492
Red=Cloning site Green=Tags(s) MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_872298 |
RefSeq Size | 3601 |
RefSeq ORF | 756 |
Synonyms | DKFZp434O0213 |
Locus ID | 91355 |
UniProt ID | A4QPB2 |
Cytogenetics | 22q11.23 |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC405514 | LRP5L HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427704 | LRP5L HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY405514 | Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1 | 100 ug |
$436.00
|
|
LY427704 | Transient overexpression lysate of low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2 | 100 ug |
$436.00
|
|
TP311399 | Recombinant protein of human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP760928 | Purified recombinant protein of Human low density lipoprotein receptor-related protein 5-like (LRP5L), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.