POLR3H (NM_001018050) Human Mass Spec Standard
CAT#: PH310633
POLR3H MS Standard C13 and N15-labeled recombinant protein (NP_001018060)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210633 |
Predicted MW | 22.9 kDa |
Protein Sequence |
>RC210633 protein sequence
Red=Cloning site Green=Tags(s) MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKV HFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDL YMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001018060 |
RefSeq Size | 4492 |
RefSeq ORF | 612 |
Synonyms | C25; RPC8; RPC22.9 |
Locus ID | 171568 |
UniProt ID | Q9Y535, A0A024R1P3 |
Cytogenetics | 22q13.2 |
Summary | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408616 | POLR3H HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422705 | POLR3H HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422706 | POLR3H HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408616 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 1 |
USD 436.00 |
|
LY422705 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3 |
USD 436.00 |
|
LY422706 | Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 2 |
USD 436.00 |
|
TP310633 | Recombinant protein of human polymerase (RNA) III (DNA directed) polypeptide H (22.9kD) (POLR3H), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review