GNG10 (NM_001017998) Human Mass Spec Standard
GNG10 MS Standard C13 and N15-labeled recombinant protein (NP_001017998)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210455 |
Predicted MW | 7.2 kDa |
Protein Sequence |
>RC210455 protein sequence
Red=Cloning site Green=Tags(s) MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001017998 |
RefSeq Size | 1269 |
RefSeq ORF | 204 |
Locus ID | 2790 |
UniProt ID | P50151, A0A024R156 |
Cytogenetics | 9q31.3 |
Summary | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400396 | GNG10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400396 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 10 (GNG10) |
USD 396.00 |
|
TP310455 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 10 (GNG10) |
USD 823.00 |