GNG10 (NM_001017998) Human Mass Spec Standard

CAT#: PH310455

GNG10 MS Standard C13 and N15-labeled recombinant protein (NP_001017998)

Product Images

Coomassie blue staining of purified GNG10 protein (Cat# TP310455). The protein was produced from HEK293T cells transfected with GNG10 cDNA clone (Cat# RC210455) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210455
• Predicted MW: 7.2 kDa
• Protein Sequence:
  Sequence Link

  >RC210455 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001017998
• RefSeq Size: 1269
• RefSeq ORF: 204
• Locus ID: 2790
• UniProt ID: P50151, A0A024R156
• Cytogenetics: 9q31.3
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway