PRR15 (NM_175887) Human Mass Spec Standard
CAT#: PH306785
PRR15 MS Standard C13 and N15-labeled recombinant protein (NP_787083)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206785 |
Predicted MW | 13.7 kDa |
Protein Sequence |
>RC206785 protein sequence
Red=Cloning site Green=Tags(s) MADSGDAGSSGPWWKSLTNSRKKSKEAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSRENQHPNLLGGAGE PPKPDKLYGDKSGSSRRNLKISRSGRFKEKRKVRATLLPEAGRSPEEAGFPGDPHEDKQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_787083 |
RefSeq Size | 1717 |
RefSeq ORF | 387 |
Locus ID | 222171 |
UniProt ID | Q8IV56, A4D1A1 |
Cytogenetics | 7p14.3 |
Summary | May have a role in proliferation and/or differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406198 | PRR15 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406198 | Transient overexpression lysate of proline rich 15 (PRR15) |
USD 436.00 |
|
TP306785 | Recombinant protein of human proline rich 15 (PRR15), 20 µg |
USD 867.00 |
|
TP710149 | Recombinant protein of human proline rich 15 (PRR15), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
{0} Product Review(s)
Be the first one to submit a review