PNMT (NM_002686) Human Mass Spec Standard

SKU
PH306586
PNMT MS Standard C13 and N15-labeled recombinant protein (NP_002677)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206586]
Predicted MW 30.9 kDa
Protein Sequence
Protein Sequence
>RC206586 protein sequence
Red=Cloning site Green=Tags(s)

MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV
SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW
QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH
LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
GL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002677
RefSeq Size 958
RefSeq ORF 846
Synonyms PENT; PNMTase
Locus ID 5409
UniProt ID P11086
Cytogenetics 17q12
Summary The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Tyrosine metabolism
Write Your Own Review
You're reviewing:PNMT (NM_002686) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400946 PNMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400946 Transient overexpression lysate of phenylethanolamine N-methyltransferase (PNMT) 100 ug
$436.00
TP306586 Recombinant protein of human phenylethanolamine N-methyltransferase (PNMT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.