SNX21 (NM_152897) Human Mass Spec Standard

SKU PH305765

SNX21 MS Standard C13 and N15-labeled recombinant protein (NP_690857)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC205765]
• Predicted MW: 21.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC205765 protein sequence; Red=Cloning site Green=Tags(s); ; MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDE; DDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANV; VKDPPSKYVLYTLTVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPQSH; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_690857
• RefSeq Size: 1921
• RefSeq ORF: 597
• Synonyms: C20orf161; dJ337O18.4; PP3993; SNX-L; SNXL
• Locus ID: 90203
• UniProt ID: Q969T3
• Cytogenetics: 20q13.12
• Summary: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. The specific function of this protein has not been determined. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome