OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNX21 (NM_152897) Human Mass Spec Standard

Be the first to review this product
SKU
PH305765
SNX21 MS Standard C13 and N15-labeled recombinant protein (NP_690857)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358293 SNX21 Antibody - N-terminal region
100 ul
$585.00
LY407259 Transient overexpression lysate of sorting nexin family member 21 (SNX21), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SNX21 or NM_152897"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205765
Predicted MW 21.9 kDa
Protein Sequence
Protein Sequence
>RC205765 protein sequence
Red=Cloning site Green=Tags(s)

MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDE
DDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANV
VKDPPSKYVLYTLTVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPQSH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_690857
RefSeq Size 1921
RefSeq ORF 597
Synonyms C20orf161; dJ337O18.4; PP3993; SNX-L; SNXL
Locus ID 90203
UniProt ID Q969T3
Cytogenetics 20q13.12
Summary This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. The specific function of this protein has not been determined. Multiple transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNX21" proteins (3)
SKU Description Size Price
LC407259 Lyophilized SNX21 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407259 Transient overexpression lysate of sorting nexin family member 21 (SNX21), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305765 Recombinant protein of human sorting nexin family member 21 (SNX21), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products