EIF4A2 (NM_001967) Human Mass Spec Standard

SKU
PH305623
EIF4A2 MS Standard C13 and N15-labeled recombinant protein (NP_001958)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205623]
Predicted MW 46.4 kDa
Protein Sequence
Protein Sequence
>RC205623 protein sequence
Red=Cloning site Green=Tags(s)

MSGGSADYNREHGGPEGMDPDGVIESSWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG
YDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTN
VRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV
VLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFL
NTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL
PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001958
RefSeq Size 1905
RefSeq ORF 1221
Synonyms BM-010; DDX2B; eIF-4A-II; EIF4A; eIF4A-II; EIF4F
Locus ID 1974
UniProt ID Q14240
Cytogenetics 3q27.3
Summary ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EIF4A2 (NM_001967) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400722 EIF4A2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400722 Transient overexpression lysate of eukaryotic translation initiation factor 4A2 (EIF4A2) 100 ug
$436.00
TP305623 Recombinant protein of human eukaryotic translation initiation factor 4A, isoform 2 (EIF4A2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.