OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFIT2 (NM_001547) Human Mass Spec Standard

Be the first to review this product
SKU
PH305582
IFIT2 MS Standard C13 and N15-labeled recombinant protein (NP_001538)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346292 Rabbit Polyclonal Anti-IFIT2 Antibody
100 ul
$585.00
LY419877 Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 2 (IFIT2) (as WB positive control) 100 ug
$436.00

Other products for "IFIT2 or NM_001547"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205582
Predicted MW 56.2 kDa
Protein Sequence
Protein Sequence
>RC205582 protein sequence
Red=Cloning site Green=Tags(s)

MSENNKNSLESSLRQLKCHFTWNLMEGENSLDDFEDKVFYRTEFQNREFKATMCNLLAYLKHLKGQNEAA
LECLRKAEELIQQEHADQAEIRSLVTWGNYAWVYYHMGRLSDVQIYVDKVRHVCEKFSSPYRIESPELDC
EEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPPSQNAIDPLRQAIRLNPDNQY
LKVLLALKLHKMREEGEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNN
AYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQY
EEAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAK
MRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGEWRIEMWCPLGYC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001538
RefSeq Size 3505
RefSeq ORF 1452
Synonyms cig42; G10P2; GARG-39; IFI-54; IFI-54K; IFI54; IFIT-2; ISG-54 K; ISG-54K; ISG54; P54
Locus ID 3433
UniProt ID P09913
Cytogenetics 10q23.31
Summary IFN-induced antiviral protein which inhibits expression of viral messenger RNAs lacking 2'-O-methylation of the 5' cap. The ribose 2'-O-methylation would provide a molecular signature to distinguish between self and non-self mRNAs by the host during viral infection. Viruses evolved several ways to evade this restriction system such as encoding their own 2'-O-methylase for their mRNAs or by stealing host cap containing the 2'-O-methylation (cap snatching mechanism). Binds AU-rich viral RNAs, with or without 5' triphosphorylation, RNA-binding is required for antiviral activity. Can promote apoptosis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFIT2" proteins (3)
SKU Description Size Price
LC419877 Lyophilized IFIT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419877 Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 2 (IFIT2) (as WB positive control) 100 ug
$436.00
TP305582 Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 2 (IFIT2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products