IFIT2 (NM_001547) Human Mass Spec Standard

SKU
PH305582
IFIT2 MS Standard C13 and N15-labeled recombinant protein (NP_001538)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205582]
Predicted MW 56.2 kDa
Protein Sequence
Protein Sequence
>RC205582 protein sequence
Red=Cloning site Green=Tags(s)

MSENNKNSLESSLRQLKCHFTWNLMEGENSLDDFEDKVFYRTEFQNREFKATMCNLLAYLKHLKGQNEAA
LECLRKAEELIQQEHADQAEIRSLVTWGNYAWVYYHMGRLSDVQIYVDKVRHVCEKFSSPYRIESPELDC
EEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPPSQNAIDPLRQAIRLNPDNQY
LKVLLALKLHKMREEGEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNN
AYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQY
EEAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAK
MRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGEWRIEMWCPLGYC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001538
RefSeq Size 3505
RefSeq ORF 1452
Synonyms cig42; G10P2; GARG-39; IFI-54; IFI-54K; IFI54; IFIT-2; ISG-54 K; ISG-54K; ISG54; P54
Locus ID 3433
UniProt ID P09913
Cytogenetics 10q23.31
Summary IFN-induced antiviral protein which inhibits expression of viral messenger RNAs lacking 2'-O-methylation of the 5' cap. The ribose 2'-O-methylation would provide a molecular signature to distinguish between self and non-self mRNAs by the host during viral infection. Viruses evolved several ways to evade this restriction system such as encoding their own 2'-O-methylase for their mRNAs or by stealing host cap containing the 2'-O-methylation (cap snatching mechanism). Binds AU-rich viral RNAs, with or without 5' triphosphorylation, RNA-binding is required for antiviral activity. Can promote apoptosis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:IFIT2 (NM_001547) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419877 IFIT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419877 Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 2 (IFIT2) 100 ug
$436.00
TP305582 Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 2 (IFIT2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.