C10orf63 (ENKUR) (NM_145010) Human Mass Spec Standard

SKU
PH305483
ENKUR MS Standard C13 and N15-labeled recombinant protein (NP_659447)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205483]
Predicted MW 29.5 kDa
Protein Sequence
Protein Sequence
>RC205483 protein sequence
Red=Cloning site Green=Tags(s)

MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEK
TLPPKKNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSG
LVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKE
FQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIANNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659447
RefSeq Size 3399
RefSeq ORF 768
Synonyms C10orf63; CFAP106
Locus ID 219670
UniProt ID Q8TC29
Cytogenetics 10p12.1
Summary This gene encodes a protein that interacts with calmodulin and several transient receptor potential canonical cation channel proteins. The encoded protein may function as an adaptor to localize signal transduction machinery to calcium channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
Write Your Own Review
You're reviewing:C10orf63 (ENKUR) (NM_145010) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408146 ENKUR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408146 Transient overexpression lysate of enkurin, TRPC channel interacting protein (ENKUR) 100 ug
$436.00
TP305483 Recombinant protein of human chromosome 10 open reading frame 63 (C10orf63), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.