EFHD2 (NM_024329) Human Mass Spec Standard

SKU
PH304948
EFHD2 MS Standard C13 and N15-labeled recombinant protein (NP_077305)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204948]
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC204948 protein sequence
Red=Cloning site Green=Tags(s)

MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIG
EPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEV
DEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEE
IKAEQEERKKQAEEMKQRKAAFKELQSTFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077305
RefSeq Size 2424
RefSeq ORF 720
Synonyms SWS1
Locus ID 79180
UniProt ID Q96C19
Cytogenetics 1p36.21
Summary May regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. Plays a role as negative regulator of the canonical NF-kappa-B-activating branch. Controls spontaneous apoptosis through the regulation of BCL2L1 abundance.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EFHD2 (NM_024329) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411309 EFHD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411309 Transient overexpression lysate of EF-hand domain family, member D2 (EFHD2) 100 ug
$436.00
TP304948 Recombinant protein of human EF-hand domain family, member D2 (EFHD2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.