OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFHD2 (NM_024329) Human Mass Spec Standard

Be the first to review this product
SKU
PH304948
EFHD2 MS Standard C13 and N15-labeled recombinant protein (NP_077305)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306945 Rabbit Polyclonal EFHD2 Antibody
100 ug
$640.00
LY411309 Transient overexpression lysate of EF-hand domain family, member D2 (EFHD2) (as WB positive control) 100 ug
$436.00

Other products for "EFHD2 or NM_024329"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204948
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC204948 protein sequence
Red=Cloning site Green=Tags(s)

MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIG
EPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEV
DEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEE
IKAEQEERKKQAEEMKQRKAAFKELQSTFK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077305
RefSeq Size 2424
RefSeq ORF 720
Synonyms SWS1
Locus ID 79180
UniProt ID Q96C19
Cytogenetics 1p36.21
Summary May regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. Plays a role as negative regulator of the canonical NF-kappa-B-activating branch. Controls spontaneous apoptosis through the regulation of BCL2L1 abundance.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EFHD2" proteins (3)
SKU Description Size Price
LC411309 Lyophilized EFHD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411309 Transient overexpression lysate of EF-hand domain family, member D2 (EFHD2) (as WB positive control) 100 ug
$436.00
TP304948 Recombinant protein of human EF-hand domain family, member D2 (EFHD2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products