OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNLY (NM_006433) Human Mass Spec Standard

Be the first to review this product
SKU
PH304321
GNLY MS Standard C13 and N15-labeled recombinant protein (NP_006424)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401936 Transient overexpression lysate of granulysin (GNLY), transcript variant NKG5 (as WB positive control) 100 ug
$436.00

Other products for "GNLY or NM_006433"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204321
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC204321 protein sequence
Red=Cloning site Green=Tags(s)

MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL
TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP
STGPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006424
RefSeq Size 751
RefSeq ORF 435
Synonyms D2S69E; LAG-2; LAG2; NKG5; TLA519
Locus ID 10578
UniProt ID P22749
Cytogenetics 2p11.2
Summary The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNLY" proteins (3)
SKU Description Size Price
LC401936 Lyophilized GNLY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401936 Transient overexpression lysate of granulysin (GNLY), transcript variant NKG5 (as WB positive control) 100 ug
$436.00
TP304321 Recombinant protein of human granulysin (GNLY), transcript variant NKG5, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products