GNLY (NM_006433) Human Mass Spec Standard

SKU
PH304321
GNLY MS Standard C13 and N15-labeled recombinant protein (NP_006424)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204321]
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC204321 protein sequence
Red=Cloning site Green=Tags(s)

MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL
TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP
STGPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006424
RefSeq Size 751
RefSeq ORF 435
Synonyms D2S69E; LAG-2; LAG2; NKG5; TLA519
Locus ID 10578
UniProt ID P22749
Cytogenetics 2p11.2
Summary The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:GNLY (NM_006433) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401936 GNLY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401936 Transient overexpression lysate of granulysin (GNLY), transcript variant NKG5 100 ug
$436.00
TP304321 Recombinant protein of human granulysin (GNLY), transcript variant NKG5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.