OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGEF1 (NM_022149) Human Mass Spec Standard

Be the first to review this product
SKU
PH304018
MAGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_071432)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351377 Rabbit Polyclonal Anti-MAGEF1 Antibody
100 ul
$205.00
LY411737 Transient overexpression lysate of melanoma antigen family F, 1 (MAGEF1) (as WB positive control) 100 ug
$436.00

Other products for "MAGEF1 or NM_022149"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204018
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC204018 protein sequence
Red=Cloning site Green=Tags(s)

MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKSLARR
RAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKH
HTYILINKLKPLEEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGY
PKRLIMEDFVQQRYLSYRRVPHTNPPAYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALAD
EADRARAKARAEASMRARASARAGIHLW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071432
RefSeq Size 1700
RefSeq ORF 924
Synonyms MAGE-F1
Locus ID 64110
UniProt ID Q9HAY2
Cytogenetics 3q27.1
Summary This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAGEF1" proteins (3)
SKU Description Size Price
LC411737 Lyophilized MAGEF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411737 Transient overexpression lysate of melanoma antigen family F, 1 (MAGEF1) (as WB positive control) 100 ug
$436.00
TP304018 Recombinant protein of human melanoma antigen family F, 1 (MAGEF1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products