MAGEF1 (NM_022149) Human Mass Spec Standard

CAT#: PH304018

MAGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_071432)

Product Images

Coomassie blue staining of purified MAGEF1 protein (Cat# TP304018). The protein was produced from HEK293T cells transfected with MAGEF1 cDNA clone (Cat# RC204018) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204018
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204018 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKSLARR
  RAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKH
  HTYILINKLKPLEEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGY
  PKRLIMEDFVQQRYLSYRRVPHTNPPAYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALAD
  EADRARAKARAEASMRARASARAGIHLW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071432
• RefSeq Size: 1700
• RefSeq ORF: 924
• Synonyms: MAGE-F1
• Locus ID: 64110
• UniProt ID: Q9HAY2
• Cytogenetics: 3q27.1
• Summary: This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region. [provided by RefSeq, Jul 2008]