MAGEF1 (NM_022149) Human Mass Spec Standard

SKU
PH304018
MAGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_071432)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204018]
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC204018 protein sequence
Red=Cloning site Green=Tags(s)

MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKSLARR
RAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKH
HTYILINKLKPLEEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGY
PKRLIMEDFVQQRYLSYRRVPHTNPPAYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALAD
EADRARAKARAEASMRARASARAGIHLW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071432
RefSeq Size 1700
RefSeq ORF 924
Synonyms MAGE-F1
Locus ID 64110
UniProt ID Q9HAY2
Cytogenetics 3q27.1
Summary This intronless gene encodes a member of the MAGE superfamily. It is ubiquitously expressed in normal tissues and in tumor cells. This gene includes a microsatellite repeat in the coding region. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MAGEF1 (NM_022149) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411737 MAGEF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411737 Transient overexpression lysate of melanoma antigen family F, 1 (MAGEF1) 100 ug
$436.00
TP304018 Recombinant protein of human melanoma antigen family F, 1 (MAGEF1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.