LMO4 (NM_006769) Human Mass Spec Standard

SKU
PH303914
LMO4 MS Standard C13 and N15-labeled recombinant protein (NP_006760)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203914]
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC203914 protein sequence
Red=Cloning site Green=Tags(s)

MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM
ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD
RPTALINGHLNSLQSNPLLPDQKVC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006760
RefSeq Size 5415
RefSeq ORF 495
Locus ID 8543
UniProt ID P61968
Cytogenetics 1p22.3
Summary This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. [provided by RefSeq, Aug 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:LMO4 (NM_006769) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402024 LMO4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402024 Transient overexpression lysate of LIM domain only 4 (LMO4) 100 ug
$436.00
TP303914 Recombinant protein of human LIM domain only 4 (LMO4), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.