Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Mass Spec Standard

SKU
PH303907
ADIPOR1 MS Standard C13 and N15-labeled recombinant protein (NP_057083)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203907]
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC203907 protein sequence
Red=Cloning site Green=Tags(s)

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP
LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT
HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS
GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV
PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV
HFYGVSNLQEFRYGLEGGCTDDTLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057083
RefSeq Size 2184
RefSeq ORF 1125
Synonyms ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Locus ID 51094
UniProt ID Q96A54
Cytogenetics 1q32.1
Summary This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway
Write Your Own Review
You're reviewing:Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402486 ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426849 ADIPOR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402486 Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 1 100 ug
$436.00
LY426849 Transient overexpression lysate of adiponectin receptor 1 (ADIPOR1), transcript variant 2 100 ug
$436.00
TP303907 Recombinant protein of human adiponectin receptor 1 (ADIPOR1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.