ABHD11 (NM_148912) Human Mass Spec Standard

SKU
PH303904
ABHD11 MS Standard C13 and N15-labeled recombinant protein (NP_683710)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203904]
Predicted MW 34.7 kDa
Protein Sequence
Protein Sequence
>RC203904 protein sequence
Red=Cloning site Green=Tags(s)

MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV
FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH
SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI
QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM
RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_683710
RefSeq Size 1467
RefSeq ORF 945
Synonyms PP1226; WBSCR21
Locus ID 83451
UniProt ID Q8NFV4
Cytogenetics 7q11.23
Summary This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq, Mar 2016]
Write Your Own Review
You're reviewing:ABHD11 (NM_148912) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407728 ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430200 ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407728 Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 1 100 ug
$436.00
LY430200 Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 2 100 ug
$436.00
TP303904 Recombinant protein of human abhydrolase domain containing 11 (ABHD11), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.