ABHD11 (NM_148912) Human Mass Spec Standard

CAT#: PH303904

ABHD11 MS Standard C13 and N15-labeled recombinant protein (NP_683710)

Product Images

Coomassie blue staining of purified ABHD11 protein (Cat# TP303904). The protein was produced from HEK293T cells transfected with ABHD11 cDNA clone (Cat# RC203904) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203904
• Predicted MW: 34.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203904 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV
  FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH
  SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI
  QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM
  RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_683710
• RefSeq Size: 1467
• RefSeq ORF: 945
• Synonyms: PP1226; WBSCR21
• Locus ID: 83451
• UniProt ID: Q8NFV4
• Cytogenetics: 7q11.23
• Summary: This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq, Mar 2016]