CNRIP1 (NM_015463) Human Mass Spec Standard

SKU
PH303901
CNRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_056278)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203901]
Predicted MW 18.6 kDa
Protein Sequence
Protein Sequence
>RC203901 protein sequence
Red=Cloning site Green=Tags(s)

MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVP
LELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPF
SVIEYECKPNETRSLMWVNKESFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056278
RefSeq Size 2037
RefSeq ORF 492
Synonyms C2orf32; CRIP-1; CRIP1
Locus ID 25927
UniProt ID Q96F85
Cytogenetics 2p14
Summary This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013]
Write Your Own Review
You're reviewing:CNRIP1 (NM_015463) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402440 CNRIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402440 Transient overexpression lysate of cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a 100 ug
$436.00
TP303901 Recombinant protein of human cannabinoid receptor interacting protein 1 (CNRIP1), transcript variant CRIP1a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.