GNGT2 (NM_031498) Human Mass Spec Standard

SKU PH303892

GNGT2 MS Standard C13 and N15-labeled recombinant protein (NP_113686)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203892]
• Predicted MW: 7.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC203892 protein sequence; Red=Cloning site Green=Tags(s); ; MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_113686
• RefSeq Size: 1057
• RefSeq ORF: 207
• Synonyms: G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8
• Locus ID: 2793
• UniProt ID: O14610
• Cytogenetics: 17q21.32
• Summary: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway